PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G12200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 331aa    MW: 35348.3 Da    PI: 6.1787
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G12200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.3e-151470148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +   +G+g+W++++++ g         ++R++k+c++r+ +yl
  LPERR03G12200.1 14 KGPWTAEEDAKLLAYTSTHGTGNWTSVPQRAGreinsiscrLKRCGKSCRLRYTNYL 70
                     79*****************************************************97 PP

2Myb_DNA-binding51.72e-1678119346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+eE++l+v ++++lG++ W++Ia+ ++ gRt++++k++w++
  LPERR03G12200.1  78 NFTQEEEDLIVTLHAMLGSR-WSLIANQLP-GRTDNDVKNYWNT 119
                      89******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-22574IPR009057Homeodomain-like
PROSITE profilePS5129413.767970IPR017930Myb domain
SuperFamilySSF466893.63E-2811117IPR009057Homeodomain-like
SMARTSM007171.1E-121372IPR001005SANT/Myb domain
PfamPF002495.3E-141470IPR001005SANT/Myb domain
CDDcd001678.56E-101670No hitNo description
PROSITE profilePS5129424.53271125IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2375125IPR009057Homeodomain-like
SMARTSM007178.5E-1575123IPR001005SANT/Myb domain
CDDcd001674.91E-1278121No hitNo description
PfamPF002497.2E-1578119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRPPCCDKA NVKKGPWTAE EDAKLLAYTS THGTGNWTSV PQRAGREINS ISCRLKRCGK  60
SCRLRYTNYL RPNLKHENFT QEEEDLIVTL HAMLGSRWSL IANQLPGRTD NDVKNYWNTK  120
LSKKLRQRGI DPITHRPIAD LMHSIGTLAI RPSPASSSNS SSYLPPTSAA SPPATLPVFL  180
HDAPYFTAHH HQHQVVTKVD ADAPASPVDE KQNHLHQQIN WSDFLADDAA AHGAVDAQAP  240
QANALGMYQE GSVAAATGVV GGRAFGDVVV DGASGGDADD GAGDASAFID AILDCDKEMG  300
VDQLIAEMLA DPAYYGGGGG GSSSSEMGWG C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141257108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3727361e-123AK372736.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3010N13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649927.11e-170PREDICTED: myb-related protein Zm38-like
TrEMBLA0A0D9VSZ10.0A0A0D9VSZ1_9ORYZ; Uncharacterized protein
STRINGOB03G23760.11e-169(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118743439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.15e-62myb domain protein 103